PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009782865.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 102aa    MW: 11479.8 Da    PI: 6.0797
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009782865.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer106.22e-333793360
     ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                    +vrY+eC+kNhAas+Gg+avDGC+Efmp  +eegt+ al+CaACgCHRnFHRreve+e
  XP_009782865.1 37 TVRYRECQKNHAASVGGYAVDGCREFMPC-DEEGTPGALTCAACGCHRNFHRREVETE 93
                    79**************************9.999*********************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2611101IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.6E-303890IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.5E-283990IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.034089IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MCHLSFQTKE MTKRQVILKK DDFSDDDSTN SSFTIRTVRY RECQKNHAAS VGGYAVDGCR  60
EFMPCDEEGT PGALTCAACG CHRNFHRREV ETEVACDCSF PT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009782865.14e-72PREDICTED: mini zinc finger protein 2
RefseqXP_016440003.14e-72PREDICTED: mini zinc finger protein 2-like
SwissprotQ9LJW51e-37MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A061EGD23e-43A0A061EGD2_THECC; Mini zinc finger 2 isoform 2 (Fragment)
TrEMBLA0A068U1651e-43A0A068U165_COFCA; Uncharacterized protein
STRINGVIT_14s0108g00810.t012e-42(Vitis vinifera)
STRINGSolyc03g061620.1.12e-42(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11052486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.12e-36mini zinc finger 2